AMAb90754

antibody from Atlas Antibodies

Targeting: CD4

Antibody data

Submit

Validation data

Product number: AMAb90754 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb90754, RRID:AB_2665653
Product name: Anti-CD4
Antibody type: Monoclonal
Reactivity: Human
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: RASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKL PLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVN LVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKE AKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESN IKVLPTWS
Isotype: IgG
Antibody clone number: CL0395
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CD4 protein structure - AMAb90754 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human tonsil and pancreas tissues using AMAb90754 antibody. Corresponding CD4 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows strong membranous immunoreactivity, mostly in non-germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: immunohistochemical staining of human duodenum shows strong membranous immunoreactivity in a subset of lymphoid cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows moderate membranous and cytoplasmic positivity, mainly in non - germinal center cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate membranous and cytoplasmic positivity in lymphoid cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows no positivity in either islets of Langerhans or exocrine glandular cells as expected.