Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AB0091-200 - Provider product page
- Provider
- SICGEN
- Proper citation
- SICGEN Cat#AB0091-200, RRID:AB_2333124
- Product name
- Anti-CD4
- Antibody type
- Polyclonal
- Description
- Goat polyclonal antibody to CD19. CD19 is a type I transmembrane glycoprotein with 2 C-type Ig domains and multiple phosphorylation sites on long cytoplasmic domain. It is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. It is a major B lineage marker.
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Donkey, Feline, Goat, Guinea Pig, Hamster, Horse, Porcine, Rabbit, Sheep, Simian, Other
- Host
- Goat
- Conjugate
- Unconjugated
- Antigen sequence
MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVE
QCCTSICSLYQLENYCN- Isotype
- IgG
- Vial size
- 600 µg
- Concentration
- 3 mg/ml
- Storage
- Store at -20 C for long-term storage. Store at 2-8 C for up to one month.
- Handling
- The antibody solution should be gently mixed before use.
Submitted references CiteAb: a searchable antibody database that ranks antibodies by the number of times they have been cited.
Helsby MA, Leader PM, Fenn JR, Gulsen T, Bryant C, Doughton G, Sharpe B, Whitley P, Caunt CJ, James K, Pope AD, Kelly DH, Chalmers AD
BMC cell biology 2014 Feb 14;15:6
BMC cell biology 2014 Feb 14;15:6
No comments: Submit comment
Supportive validation
- Submitted by
- SICGEN (provider)
- Main image
- Experimental details
- Endogenous CD4 detected with AB0091 at 1/500 dilution; lysate at 100 µg per lane
- Sample type
- Spleen
- Primary Ab dilution
- 1/500
- Conjugate
- Unconjugated
- Secondary Ab
- Secondary Ab
- Secondary Ab dilution
- 1/10,000