Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004252 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004252, RRID:AB_1078466
- Product name
- Anti-CD4
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKL
PLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVN
LVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKE
AKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESN
IKVLPTWS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The Immune Microenvironment Landscape of Pituitary NeuroEndocrine Tumors, a Transcriptomic Approach
C5aR1 blockade reshapes immunosuppressive tumor microenvironment and synergizes with immune checkpoint blockade therapy in high-grade serous ovarian cancer
Spatial Analysis of NQO1 in Non-Small Cell Lung Cancer Shows Its Expression Is Independent of NRF1 and NRF2 in the Tumor Microenvironment
Cigarette smoke promotes HIV infection of primary bronchial epithelium and additively suppresses CFTR function
GABAergic Local Interneurons Shape Female Fruit Fly Response to Mating Songs
AP-2 Is the Crucial Clathrin Adaptor Protein for CD4 Downmodulation by HIV-1 Nef in Infected Primary CD4 + T Cells
A gustatory second-order neuron that connects sucrose-sensitive primary neurons and a distinct region of the gnathal ganglion in theDrosophilabrain
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Vela-Patiño S, Salazar M, Taniguchi-Ponciano K, Vadillo E, Gomez-Apo E, Escobar-España A, Perez-Koldenkova V, Bonifaz L, Aguilar-Flores C, Marrero-Rodríguez D, Mercado M
Genes 2024;15(5):531
Genes 2024;15(5):531
C5aR1 blockade reshapes immunosuppressive tumor microenvironment and synergizes with immune checkpoint blockade therapy in high-grade serous ovarian cancer
Zhang C, Cao K, Yang M, Wang Y, He M, Lu J, Huang Y, Zhang G, Liu H
OncoImmunology 2023;12(1)
OncoImmunology 2023;12(1)
Spatial Analysis of NQO1 in Non-Small Cell Lung Cancer Shows Its Expression Is Independent of NRF1 and NRF2 in the Tumor Microenvironment
Kaghazchi B, Um I, Elshani M, Read O, Harrison D
Biomolecules 2022;12(11):1652
Biomolecules 2022;12(11):1652
Cigarette smoke promotes HIV infection of primary bronchial epithelium and additively suppresses CFTR function
Chinnapaiyan S, Dutta R, Bala J, Parira T, Agudelo M, Nair M, Unwalla H
Scientific Reports 2018;8(1)
Scientific Reports 2018;8(1)
GABAergic Local Interneurons Shape Female Fruit Fly Response to Mating Songs
Yamada D, Ishimoto H, Li X, Kohashi T, Ishikawa Y, Kamikouchi A
The Journal of Neuroscience 2018;38(18):4329-4347
The Journal of Neuroscience 2018;38(18):4329-4347
AP-2 Is the Crucial Clathrin Adaptor Protein for CD4 Downmodulation by HIV-1 Nef in Infected Primary CD4 + T Cells
Gondim M, Wiltzer-Bach L, Maurer B, Banning C, Arganaraz E, Schindler M, Silvestri G
Journal of Virology 2015;89(24):12518-12524
Journal of Virology 2015;89(24):12518-12524
A gustatory second-order neuron that connects sucrose-sensitive primary neurons and a distinct region of the gnathal ganglion in theDrosophilabrain
Miyazaki T, Lin T, Ito K, Lee C, Stopfer M
Journal of Neurogenetics 2015;29(2-3):144-155
Journal of Neurogenetics 2015;29(2-3):144-155
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Kato B, Nicholson G, Neiman M, Rantalainen M, Holmes C, Barrett A, Uhlén M, Nilsson P, Spector T, Schwenk J
Proteome Science 2011;9(1):73
Proteome Science 2011;9(1):73
No comments: Submit comment
No validations: Submit validation data