HPA004252

CD4 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004252, RRID:AB_1078466
Product name
Anti-CD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004252
Antibody type
Polyclonal
Antigen
T-cell surface glycoprotein CD4 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKL
PLHLTLPQALPQYAGSGNLTLALEAKTGKLHQEVN
LVVMRATQLQKNLTCEVWGPTSPKLMLSLKLENKE
AKVSKREKAVWVLNPEAGMWQCLLSDSGQVLLESN
IKVLPTWS
Storage
-20C
Provider Type Product Number
- No reagents -