Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010661-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010661-M02, RRID:AB_894161
- Product name
- KLF1 monoclonal antibody (M02), clone 4E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLF1.
- Antigen sequence
PRTGLSVPAASGAPYGLLSGYPAMYPAPQYQGHFQ
LFRGLQGPAPGPATSPSFLS- Isotype
- IgG
- Antibody clone number
- 4E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Garlic accelerates red blood cell turnover and splenic erythropoietic gene expression in mice: evidence for erythropoietin-independent erythropoiesis.
Akgül B, Lin KW, Ou Yang HM, Chen YH, Lu TH, Chen CH, Kikuchi T, Chen YT, Tu CP
PloS one 2010 Dec 29;5(12):e15358
PloS one 2010 Dec 29;5(12):e15358
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KLF1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol