Antibody data

Product number
H00054606-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054606-M05, RRID:AB_530023
Product name
DDX56 monoclonal antibody (M05), clone 4C5
Provider product page
Abnova Corporation - H00054606-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DDX56.
Antigen sequence
IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAV
VKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCR
KAKRAKSQNPLRSFKHKGKKFRPTAKPS
Isotype
IgG
Antibody clone number
4C5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -