Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00054606-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00054606-M03, RRID:AB_1112529
- Product name
- DDX56 monoclonal antibody (M03), clone 6B9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant DDX56.
- Antigen sequence
IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAV
VKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCR
KAKRAKSQNPLRSFKHKGKKFRPTAKPS- Isotype
- IgG
- Antibody clone number
- 6B9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Quantitative proteomics and dynamic imaging of the nucleolus reveal distinct responses to UV and ionizing radiation.
Moore HM, Bai B, Boisvert FM, Latonen L, Rantanen V, Simpson JC, Pepperkok R, Lamond AI, Laiho M
Molecular & cellular proteomics : MCP 2011 Oct;10(10):M111.009241
Molecular & cellular proteomics : MCP 2011 Oct;10(10):M111.009241
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged DDX56 is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol