HPA019749

DDX56 antibody from Sigma-Aldrich
NOH61
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019749
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019749, RRID:AB_1847579
Product name
Anti-DDX56 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019749
Antibody type
Polyclonal
Antigen
Probable ATP-dependent RNA helicase DDX56 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYC
ARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSR
ILSHLQQDSLKLRDS
Storage
-20C
Provider Type Product Number
- No reagents -