HPA017892

ZNF408 antibody from Atlas Antibodies
FLJ12827
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017892
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017892, RRID:AB_1859248
Product name
Anti-ZNF408
Provider product page
Atlas Antibodies - HPA017892
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AAVAVVTEVESAVQQEVASPGEDAAEPCIDPGSQS
PSGIQAENMVSPGLKFPTQDRISKDSQPLGPLLQD
GDVDEECPAQAQMPPELQSNSATQQDPDGSGASFS
SSARGTQPHGYLAKKLHSPSDQCPPRAKTPEPGAQ
QSGFPTLSRS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -