HPA023329

ATPAF2 antibody from Atlas Antibodies
ATP12, Atp12p, LP3663, MGC29736
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023329
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023329, RRID:AB_1845209
Product name
Anti-ATPAF2
Provider product page
Atlas Antibodies - HPA023329
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAV
KFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEK
RYGVEISSSTSIMGPSIPAKT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -