HPA023329

ATPAF2 antibody from Sigma-Aldrich
ATP12, Atp12p, LP3663, MGC29736
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023329
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023329, RRID:AB_1845209
Product name
Anti-ATPAF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023329
Antibody type
Polyclonal
Antigen
ATP synthase mitochondrial F1 complex assembly factor 2 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAV
KFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEK
RYGVEISSSTSIMGPSIPAKT
Storage
-20C
Provider Type Product Number
- No reagents -