ABIN630054

antibody from antibodies-online

Targeting: TMED4 HNLF, p24a3, p24alpha3

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN630054 - Provider product page
Provider: antibodies-online
Product name: anti-Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4) (N-Term) antibody
Antibody type: Polyclonal
Antigen: TMED4 antibody was raised using the N terminal of TMED4 corresponding to a region with amino acids LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRT
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

TMED4 protein structure - ABIN630054 shown in red.