Explore
Validate
Learn
Western blot
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184091 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the N terminal of human TMED4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LRAMGRQALLLLALCATGAQGLYFHIGETEKRCFI
EEIPD ETMVIGNYRT- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
Otsuki T, Ota T, Nishikawa T, Hayashi K, Suzuki Y, Yamamoto J, Wakamatsu A, Kimura K, Sakamoto K, Hatano N, Kawai Y, Ishii S, Saito K, Kojima S, Sugiyama T, Ono T, Okano K, Yoshikawa Y, Aotsuka S, Sasaki N, Hattori A, Okumura K, Nagai K, Sugano S, Isogai T
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
DNA research : an international journal for rapid publication of reports on genes and genomes 2005;12(2):117-26
No comments: Submit comment
No validations: Submit validation data