Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310125 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the middle region of human TMED4
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVE
QIQKE QDYQRYREER- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Novel oxidative stress-responsive gene ERS25 functions as a regulator of the heat-shock and cell death response.
Hwang SO, Boswell SA, Seo JS, Lee SW
The Journal of biological chemistry 2008 May 9;283(19):13063-9
The Journal of biological chemistry 2008 May 9;283(19):13063-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting