Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - PAB20282 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#PAB20282, RRID:AB_10964481
 - Product name
 - VEZT polyclonal antibody
 - Antibody type
 - Polyclonal
 - Description
 - Rabbit polyclonal antibody raised against recombinant VEZT.
 - Antigen sequence
 DELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQ
ASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPH
CTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDID
SDFRKDDFYYLSQEDKERQKREHEESKRVLQELKS
VLG- Isotype
 - IgG
 - Storage
 - Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with VEZT polyclonal antibody (Cat # PAB20282) at 1:250-1:500 dilution.
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunohistochemical staining of human small intestine with VEZT polyclonal antibody (Cat # PAB20282) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)