HPA004811

VEZT antibody from Sigma-Aldrich
DKFZP761C241
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004811
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004811, RRID:AB_1080563
Product name
Anti-VEZT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004811
Antibody type
Polyclonal
Antigen
Vezatin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DELEKLVCTKETQELVSEAYPILEQKLKLIQPHVQ
ASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPH
CTVVPLKQPTLHIADKDPIPEEQELEAYVDDIDID
SDFRKDDFYYLSQEDKERQKREHEESKRVLQELKS
VLG
Storage
-20C
Provider Type Product Number
- No reagents -