HPA023183

NUDCD1 antibody from Atlas Antibodies
CML66, FLJ14991
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023183
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023183, RRID:AB_1854695
Product name
Anti-NUDCD1
Provider product page
Atlas Antibodies - HPA023183
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERL
MHLTSEELNPNPDKEKPPCNAQELEECDIFFEESS
SLCRFDGNTLKTTHVVNLGSNQYL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -