HPA023183

NUDCD1 antibody from Sigma-Aldrich
CML66, FLJ14991
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023183
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023183, RRID:AB_1854695
Product name
Anti-NUDCD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023183
Antibody type
Polyclonal
Antigen
NudC domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IKKNEGLTWPELVIGDKQGELIRDSAQCAAIAERL
MHLTSEELNPNPDKEKPPCNAQELEECDIFFEESS
SLCRFDGNTLKTTHVVNLGSNQYL
Storage
-20C
Provider Type Product Number
- No reagents -