HPA020347

OGDH antibody from Sigma-Aldrich
E1k
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020347
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020347, RRID:AB_1854773
Product name
Anti-OGDH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020347
Antibody type
Polyclonal
Antigen
2-oxoglutarate dehydrogenase E1 component, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRNTNAGAPPGTAYQSPLPLSRGSLAAVAHAQSLV
EAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQ
Storage
-20C
Provider Type Product Number
- No reagents -