HPA024253

SPATA31E1 antibody from Atlas Antibodies
C9orf79, FAM75E1, FLJ35866
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024253
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024253, RRID:AB_1845839
Product name
Anti-SPATA31E1
Provider product page
Atlas Antibodies - HPA024253
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSE
AFPTGHKGRGCSQPPTCSLVGRTWQSRTVLESGKP
KPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRAL
QVLSIGSQWARAEDA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -