PAB21669

SPATA31E1 antibody from Abnova Corporation
C9orf79, FAM75E1, FLJ35866

Antibody data

Product number
PAB21669
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21669, RRID:AB_10962207
Product name
FAM75E1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21669
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM75E1.
Antigen sequence
VPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSE
AFPTGHKGRGCSQPPTCSLVGRTWQSRTVLESGKP
KPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRAL
QVLSIGSQWARAEDA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -