HPA024253

SPATA31E1 antibody from Sigma-Aldrich
C9orf79, FAM75E1, FLJ35866
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024253
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024253, RRID:AB_1845839
Product name
Anti-C9orf79 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024253
Antibody type
Polyclonal
Antigen
FAM75-like protein C9orf79 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VPTVSGPLAAPPPEQEGVQRPPRGSQSADTHGRSE
AFPTGHKGRGCSQPPTCSLVGRTWQSRTVLESGKP
KPRLEGSMGSEMAGNEAWLESESMSPGDPCSSRAL
QVLSIGSQWARAEDA
Storage
-20C
Provider Type Product Number
- No reagents -