Antibody data

Product number
H00009166-M04
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009166-M04, RRID:AB_1204296
Product name
EBAG9 monoclonal antibody (M04), clone 4A10
Provider product page
Abnova Corporation - H00009166-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant EBAG9.
Antigen sequence
MAITQFRLFKFCTCLATVFSFLKRLICRSGRGRKL
SGDQITLPTTVDYSSVPKQTDVEEWTSWDEDAPTS
VKIEGGNGNVATQQNSLEQLEPDYFKDMTPTIRKT
QKIVIKKREPLNFGIPDGSTGFSSRLAATQDLPFI
HQSSELGDLDTWQENTNAWEEEEDAAWQAEEVLRQ
QKLADREKRAAEQQRKKMEKEAQRLMKKEQNKIGV
KLS
Isotype
IgG
Antibody clone number
4A10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -