HPA004726

VCAN antibody from Sigma-Aldrich
CSPG2, PG-M
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004726
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004726, RRID:AB_1080561
Product name
Anti-CSPG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004726
Antibody type
Polyclonal
Antigen
Versican core protein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLSGKVSLPCHFSTMPTLPPSYNTSEFLRIKWSKI
EVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVP
THPEAVGDASLTVVKLLASDAGLYRCDVMYGIEDT
QDTVSLTVDGVVFHYRAATSRYTLNFEAA
Storage
-20C
Provider Type Product Number
- No reagents -