HPA023569

LLGL1 antibody from Atlas Antibodies
DLG4, HUGL, HUGL-1, Lgl1, LLGL, Mgl1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023569
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023569, RRID:AB_1852928
Product name
Anti-LLGL1
Provider product page
Atlas Antibodies - HPA023569
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
STVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYG
PFPCKAINKILWRNCESGGHFIIFSGGMPRASYG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -