HPA022924

LLGL1 antibody from Sigma-Aldrich
DLG4, HUGL, HUGL-1, Lgl1, LLGL, Mgl1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022924
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022924, RRID:AB_1852926
Product name
Anti-LLGL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022924
Antibody type
Polyclonal
Antigen
Lethal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FERFSLSARNITEPLCSLDINWPRDATQASYRIRE
SPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTP
EPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKD
FLGSSEESEKNLRNLAEDE
Storage
-20C
Provider Type Product Number
- No reagents -