Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005478-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005478-M01, RRID:AB_425607
- Product name
- PPIA monoclonal antibody (M01), clone 1F4-1B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PPIA.
- Antigen sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAEN
FRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH
NGTGGKSIYGEKFEDENFILKHTGPGILSMANAGP
NTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE
AMERFGSRNGKTSKKITIADCGQLE- Isotype
- IgG
- Antibody clone number
- 1F4-1B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Establishment of a novel cell line for the enhanced production of recombinant adeno-associated virus vectors for gene therapy.
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Tissue proteomics reveals differential and compartment-specific expression of the homologs transgelin and transgelin-2 in lung adenocarcinoma and its stroma.
Satkunanathan S, Wheeler J, Thorpe R, Zhao Y
Human gene therapy 2014 Nov;25(11):929-41
Human gene therapy 2014 Nov;25(11):929-41
Peripheral blood monocyte-expressed ANXA2 gene is involved in pathogenesis of osteoporosis in humans.
Deng FY, Lei SF, Zhang Y, Zhang YL, Zheng YP, Zhang LS, Pan R, Wang L, Tian Q, Shen H, Zhao M, Lundberg YW, Liu YZ, Papasian CJ, Deng HW
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
Molecular & cellular proteomics : MCP 2011 Nov;10(11):M111.011700
Tissue proteomics reveals differential and compartment-specific expression of the homologs transgelin and transgelin-2 in lung adenocarcinoma and its stroma.
Rho JH, Roehrl MH, Wang JY
Journal of proteome research 2009 Dec;8(12):5610-8
Journal of proteome research 2009 Dec;8(12):5610-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PPIA monoclonal antibody (M01), clone 1F4-1B5 Western Blot analysis of PPIA expression in Jurkat ( Cat # L017V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of PPIA expression in transfected 293T cell line by PPIA monoclonal antibody (M01), clone 1F4-1B5.Lane 1: PPIA transfected lysate(18 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged PPIA is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol