HPA004812

CDH1 antibody from Atlas Antibodies
CD324, UVO, uvomorulin
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004812
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004812, RRID:AB_1078369
Product name
Anti-CDH1
Provider product page
Atlas Antibodies - HPA004812
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIF
FCERNPKPQVINIIDADLPPNTSPFTAELTHGASA
NWTIQYNDPTQESIILKPKMALEVGDYKINLKLMD
NQNKDQVTTLEVSVCDCEGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -