HPA004812

antibody from Atlas Antibodies

Targeting: CDH1 CD324, UVO, uvomorulin

Antibody data

Submit

Validation data

Product number: HPA004812 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA004812, RRID:AB_1078369
Product name: Anti-CDH1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIF FCERNPKPQVINIIDADLPPNTSPFTAELTHGASA NWTIQYNDPTQESIILKPKMALEVGDYKINLKLMD NQNKDQVTTLEVSVCDCEGA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CDH1 protein structure - HPA004812 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human colon and testis tissues using HPA004812 antibody. Corresponding CDH1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows membranous positivity in distal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon shows moderate positivity in plasma membrane in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows moderate positivity in plasma membrane in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma membrane of glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Sample type: HUMAN