Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003371-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003371-A01, RRID:AB_462487
- Product name
- TNC polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant TNC.
- Antigen sequence
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGED
CSQLACPSDCNDQGKCVNGVCICFEGYAGADCSRE
ICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCL
NNCYN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Glycoproteomic analysis of glioblastoma stem cell differentiation.
He J, Liu Y, Zhu TS, Xie X, Costello MA, Talsma CE, Flack CG, Crowley JG, Dimeco F, Vescovi AL, Fan X, Lubman DM
Journal of proteome research 2011 Jan 7;10(1):330-8
Journal of proteome research 2011 Jan 7;10(1):330-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TNC polyclonal antibody (A01), Lot # 051011JC01 Western Blot analysis of TNC expression in SJCRH30 ( Cat # L027V1 ).