HPA004823

TNC antibody from Sigma-Aldrich
DFNA56, HXB, MGC167029, TN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004823, RRID:AB_1080243
Product name
Anti-TNC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004823
Antibody type
Polyclonal
Antigen
Tenascin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTAL
DGPSGLVTANITDSEALARWQPAIATVDSYVISYT
GEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFA
EKGPQKSSTITAKFTTDLDSPRDLTATEV
Storage
-20C
Provider Type Product Number
- No reagents -