HPA026896

MAN2A1 antibody from Sigma-Aldrich
GOLIM7, MANA2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026896, RRID:AB_1853512
Product name
Anti-MAN2A1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026896
Antibody type
Polyclonal
Antigen
Alpha-mannosidase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVVYNPLEQDRISLVSVYVSSPTVQVFSASGKPVE
VQVSAVWDTANTISETAYEISFRAHIPPLGLKVYK
ILESASSNSHLADYVLYKNKVEDSGIFTIKNMINT
EEGITLENSFVLLRFDQTGLMKQMMTKED
Storage
-20C
Provider Type Product Number
- No reagents -