Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005886-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005886-M01, RRID:AB_464248
- Product name
- RAD23A monoclonal antibody (M01), clone 3C12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAD23A.
- Antigen sequence
EDAASTLVTGSEYETMLTEIMSMGYERERVVAALR
ASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSE
QPATEAAGENPLEFLRDQPQFQNMRQVIQQ- Isotype
- IgG
- Antibody clone number
- 3C12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references hHR23A is required to control the basal turnover of Chk1.
Cisplatin transiently up-regulates hHR23 expression through enhanced translational efficiency in A549 adenocarcinoma cells.
Tan X, Liang RY, Chuang SM
Cellular signalling 2015 Nov;27(11):2304-13
Cellular signalling 2015 Nov;27(11):2304-13
Cisplatin transiently up-regulates hHR23 expression through enhanced translational efficiency in A549 adenocarcinoma cells.
Shen YH, Chen BR, Cherng SH, Chueh PJ, Tan X, Lin YW, Lin JC, Chuang SM
Toxicology letters 2011 Sep 10;205(3):341-50
Toxicology letters 2011 Sep 10;205(3):341-50
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RAD23A is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol