Antibody data

Product number
H00001903-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001903-M02, RRID:AB_1237691
Product name
EDG3 monoclonal antibody (M02), clone 2G11
Provider product page
Abnova Corporation - H00001903-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant EDG3.
Antigen sequence
SKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSR
SKSSSSNNSSHSPKVKEDLPHTAPSSCIMDKNAAL
QNGIFCN
Isotype
IgG
Antibody clone number
2G11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -