HPA016736

ZNF22 antibody from Sigma-Aldrich
HKR-T1, KOX15, Zfp422, ZNF422
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016736, RRID:AB_1859133
Product name
Anti-ZNF22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016736
Antibody type
Polyclonal
Antigen
Zinc finger protein 22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRK
TRGKNIRVKTHLPSWKAGTGRKSVAGLR
Storage
-20C
Provider Type Product Number
- No reagents -