HPA016736

ZNF22 antibody from Atlas Antibodies
HKR-T1, KOX15, Zfp422, ZNF422
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA016736
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA016736, RRID:AB_1859133
Product name
Anti-ZNF22
Provider product page
Atlas Antibodies - HPA016736
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRK
TRGKNIRVKTHLPSWKAGTGRKSVAGLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -