Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405728 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Desmoglein 2 (DSG2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DSG2 antibody: synthetic peptide directed towards the N terminal of human DSG2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
KIHSDLAEERGLKITYKYTGKGITEPPFGIFVFNK
DTGEL NVTSILDREE- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A new model of development of the mammalian ovary and follicles.
The most widespread desmosomal cadherin, desmoglein 2, is a novel target of caspase 3-mediated apoptotic machinery.
Hummitzsch K, Irving-Rodgers HF, Hatzirodos N, Bonner W, Sabatier L, Reinhardt DP, Sado Y, Ninomiya Y, Wilhelm D, Rodgers RJ
PloS one 2013;8(2):e55578
PloS one 2013;8(2):e55578
The most widespread desmosomal cadherin, desmoglein 2, is a novel target of caspase 3-mediated apoptotic machinery.
Cirillo N, Lanza M, De Rosa A, Cammarota M, La Gatta A, Gombos F, Lanza A
Journal of cellular biochemistry 2008 Feb 1;103(2):598-606
Journal of cellular biochemistry 2008 Feb 1;103(2):598-606
No comments: Submit comment
No validations: Submit validation data