HPA004896

DSG2 antibody from Sigma-Aldrich
CDHF5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004896
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004896, RRID:AB_1078643
Product name
Anti-DSG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004896
Antibody type
Polyclonal
Antigen
Desmoglein-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APPEDKVVPSFLPVDQGGSLVGRNGVGGMAKEATM
KGSSSASIVKGQHEMSEMDGRWEEHRSLLSGRATQ
FTGATGAIMTTETTKTARATGASRDMAGAQAAAVA
LNEEFLRNYFTDKAASYTEEDENHTAKDCLLVYSQ
EETESLNAS
Storage
-20C
Provider Type Product Number
- No reagents -