Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184184 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-V-Akt Murine Thymoma Viral Oncogene Homolog 1 (AKT1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AKT1 antibody: synthetic peptide directed towards the N terminal of human AKT1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKL
LGKGT FGKVILVKEK- Vial size
- 50 µg
Submitted references Expression of caveolin-1 is correlated with Akt-1 in colorectal cancer tissues.
Kim HA, Kim KH, Lee RA
Experimental and molecular pathology 2006 Apr;80(2):165-70
Experimental and molecular pathology 2006 Apr;80(2):165-70
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-AKT1 Antibody Positive Control: Lane 1:541 μg preterm baboon muscle homogenate Lane 2: 041 μg preterm baboon muscle homogenate Lane 3: 041 μg term baboon muscle homogenate Lane 4: 041 μg term baboon muscle homogenate Lane 5: 041 μg adult baboon muscle homogenate Lane 6: 041 μg adult baboon muscle homogenate Primary Antibody Dilution: 1:0666Secondary Antibody: Anti-rabbit-HRP Secondry Antibody Dilution: 1:0200Submitted by: Cynthia Blanco, University of Texas Health Science Center