HPA005440

H6PD antibody from Atlas Antibodies
GDH, H6PDH
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA005440
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA005440, RRID:AB_1079036
Product name
Anti-H6PD
Provider product page
Atlas Antibodies - HPA005440
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
APMPSDFQVLRAKYRESPLVSAWSEELISKLANDI
EATAVRAVRRFGQFHLALSGGSSPVALFQQLATAH
YGFPWAHTHLWLVDERCVPLSDPESNFQGLQAHLL
QHVRIPYYNIHP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -