HPA004824

H6PD antibody from Sigma-Aldrich
GDH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004824
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004824, RRID:AB_1079037
Product name
Anti-H6PD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004824
Antibody type
Polyclonal
Antigen
GDH/6PGL endoplasmic bifunctional protein precursor [Includes: Glucose 1-dehydrogenase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WQGLFQLYLDEAGRGHSFSFHGAALTAPKQGQELM
AKALESLSCPKDMAPSHCAEHKDQFLQLSQYRQLK
TAEDYQALNKDIEAQLQHAGLREAGRIFYFSVPPF
AYEDIAR
Storage
-20C
Provider Type Product Number
- No reagents -