HPA017000

UTS2 antibody from Sigma-Aldrich
PRO1068, U-II, UCN2, UII
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017000
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017000, RRID:AB_1858656
Product name
Anti-UTS2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017000
Antibody type
Polyclonal
Antigen
Urotensin-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNVFHLMLCVTSARTHKSTSLCFGHFNSYPSLPLI
HDLLLEISFQLSAPHEDARLTPEELERASLLQILP
EMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSG
QDPNILLSHLLARIWKPYKKRETPDCFWKYCV
Storage
-20C
Provider Type Product Number
- No reagents -