HPA026078

ARFGEF2 antibody from Sigma-Aldrich
BIG2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026078
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026078, RRID:AB_1844983
Product name
Anti-ARFGEF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026078
Antibody type
Polyclonal
Antigen
Brefeldin A-inhibited guanine nucleotide-exchange protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTT
PEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLS
GTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPER
VLGELECQECAIPPGVDENSQTNGI
Storage
-20C
Provider Type Product Number
- No reagents -