HPA021669

CCM2 antibody from Atlas Antibodies
C7orf22, MGC4607, OSM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021669
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021669, RRID:AB_1846186
Product name
Anti-CCM2
Provider product page
Atlas Antibodies - HPA021669
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTER
RPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLT
SIPGYLNPSSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -