H00083605-B01P

CCM2 antibody from Abnova Corporation
C7orf22, MGC4607, OSM

Antibody data

Product number
H00083605-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083605-B01P, RRID:AB_1137578
Product name
CCM2 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00083605-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CCM2 protein.
Antigen sequence
MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEK
VTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYL
GQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHL
TQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA
AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSR
GLSAGSLSESAVGPVEACCLVILAAESKVAAEELC
CLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLS
LHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS
PHSKTISESELSASATELLQDYMLTLRTKLSSQEI
QQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL
LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSF
GRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -