HPA021669

CCM2 antibody from Sigma-Aldrich
C7orf22, MGC4607, OSM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021669
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021669, RRID:AB_1846186
Product name
Anti-CCM2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021669
Antibody type
Polyclonal
Antigen
Malcavernin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTER
RPLHTVVLSLPERVEPDRLLSDYIEKEVKYLGQLT
SIPGYLNPSSR
Storage
-20C
Provider Type Product Number
- No reagents -