HPA004827

USP13 antibody from Sigma-Aldrich
IsoT-3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004827
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004827, RRID:AB_1080497
Product name
Anti-USP13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004827
Antibody type
Polyclonal
Antigen
Ubiquitin carboxyl-terminal hydrolase 13 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKAVYFTGNMGAEVAFNWIIVHMEEPDFAEPLTMP
GYGGAASAGASVFGASGLDNQPPEEIVAIITSMGF
QRNQAIQALRATNNNLERALDWIFSHPEFEEDSDF
VIEMENNANANIISEAKPEGPRVKDGSGTYELFAF
ISH
Storage
-20C
Provider Type Product Number
- No reagents -