HPA021238

NACC1 antibody from Atlas Antibodies
BEND8, BTBD14B, BTBD30, NAC-1, NAC1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021238
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021238, RRID:AB_1845475
Product name
Anti-NACC1
Provider product page
Atlas Antibodies - HPA021238
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSM
MNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLP
AELINQIGNRCH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -