HPA021238

NACC1 antibody from Sigma-Aldrich
BEND8, BTBD14B, BTBD30, NAC-1, NAC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021238
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021238, RRID:AB_1845475
Product name
Anti-NACC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021238
Antibody type
Polyclonal
Antigen
Nucleus accumbens-associated protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGSYHNEEDEEEDGGEEGMDEQYRQICNMYTMYSM
MNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLP
AELINQIGNRCH
Storage
-20C
Provider Type Product Number
- No reagents -