HPA024646

SMCR8 antibody from Atlas Antibodies
DENND8A, FLJ34716
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024646
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024646, RRID:AB_1857284
Product name
Anti-SMCR8
Provider product page
Atlas Antibodies - HPA024646
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FQASISPPELGETEEGSIENTPSQIDSSCCIGKES
DGQLVLPSTPAHTHSDEDGVVSSPPQRHRQKDQGF
RVDFSVENANPSSRDNSCEGFPAY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -