HPA021557

SMCR8 antibody from MilliporeSigma / Merck KGaA
DENND8A, FLJ34716
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021557
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021557, RRID:AB_1857283
Product name
Anti-SMCR8 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021557
Antibody type
Polyclonal
Antigen
Smith-Magenis syndrome chromosomal region candidate gene 8 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQASTTSNPDESADTDLYTCRPAYTPKLIKAKSTK
CFDKKLKTLEELCDTEYFTQTLAQLSHIEHMFRGD
LCYLLTSQIDRALLKQQHITNFLFEDFVEVDDRMV
EKQESIPSKPSQD
Storage
-20C
Provider Type Product Number
- No reagents -